background preloader

Mahendra Kumar Trivedi

Mahendra Kumar Trivedi
My NCBI retains user information and database preferences to provide customized services for many NCBI databases. My NCBI Overview My NCBI features include: Save searches & automatic e-mail alerts Display format preferences Filter options My Bibliography & NIH public access policy complianceSciENcv: a researcher biosketch profile service Highlighting search terms Recent activity searches & records for 6 months LinkOut, document delivery service & outside tool selections NIH funded investigator? Extramural NIH-funded investigators looking for NIH Public Access Compliance tools can sign in with either "eRA Commons" or "NIH Login". Documentation for using these features is located in the Managing Compliance to the NIH Public Access Policy section of the NCBI Help Manual. Information about the NIH Public Access Policy is located at Account Troubleshooting FAQ Expired email confirmation link message Multiple My NCBI accounts Link eRA Commons, University, or other account to your NCBI account

https://www.ncbi.nlm.nih.gov/account/?back_url=http%3A%2F%2Fwww.ncbi.nlm.nih.gov%2Fmyncbi%2Fmahendrakumartrivedi%2Fcv%2F79970%2F

Mahendra Kumar Trivedi (0000-0002-2548-780X) - ORCID Mahendra Kumar Trivedi completed his 5-year Bachelor’s degree in Mechanical Engineering in 1985 and had worked as an Engineer for 10 years. In 1995, Mr. Trivedi discovered his unique ability to harness the energy from the universe and transmit it to anywhere on the globe, infusing it into living organisms and nonliving materials, thus optimizing their potential. For the next 5-7 years, Mahendra Trivedi applied this newfound discovery to helping people to optimize their potential, and this unique phenomenon resulting from Mr. Trivedi’s biofield energy treatments became internationally renowned as The Trivedi Effect®. There are many major and world-renowned scientists and other individuals that are identified as “experts” in the areas of consciousness and biofield energy, each with their own interpretation or assessment of the nature or origin of The Trivedi Effect® through the lens of their personal knowledge and expertise.

Epernicus: Mahendra Kumar Trivedi, B. Tech. Research: Mahendra Kumar Trivedi earned his 5-year Bachelor’s degree in Mechanical Engineering in 1985 and worked as an Engineer for 10 years. In 1995, Mr. Trivedi discovered that he had the unique ability to harness the energy from the universe and transmit it to anywhere on the globe, infusing it into living organisms and nonliving materials, thus optimizing their potential.

Spectroscopic Characterization of Disulfiram and Nicotinic Acid after Biofield Treatment Trivedi, M. K. (2015), 'Spectroscopic Characterization of Disulfiram and Nicotinic Acid after Biofield Treatment'. %0 Thesis %1 mahendrakumartrivedi %A Trivedi, Mahendra Kumar %B Spectroscopic Characterization of Disulfiram and Nicotinic Acid after Biofield Treatment %D 2015 %I Mahendra Kumar Trivedi %J Analytical & Bioanalytical Techniques %K biofield mahendrakumartrivedi myown %N 5 %T Spectroscopic Characterization of Disulfiram and Nicotinic Acid after Biofield Treatment %U %V 6 %X Disulfiram is being used clinically as an aid in chronic alcoholism, while nicotinic acid is one of a B-complex vitamin that has cholesterol lowering activity.

Mahendra Kumar Trivedi Mahendra Kumar Trivedi completed his 5-year Bachelor’s degree in Mechanical Engineering in 1985 and had worked as an Engineer for 10 years. In 1995, Mr. Trivedi discovered has the unique ability to harness the energy from the universe and transmit it to anywhere on the globe, infusing it into living organisms and nonliving materials, thus optimizing their potential. For the next 5-7 years, Trivedi applied this newfound discovery to helping people optimize their potential, and this unique phenomenon resulting from Mr. Mahendra Kumar Trivedi The objective of the current study was to evaluate the effect of biofield energy treatment on the isotopic abundance ratios of P M+1/PM, PM+2/PM, PM+3/PMand PM+4/PM in p-DCB using gas chromatography-mass spectrometry ... more abstractThe objective of the current study was to evaluate the effect of biofield energy treatment on the isotopic abundance ratios of P M+1/PM, PM+2/PM, PM+3/PMand PM+4/PM in p-DCB using gas chromatography-mass spectrometry (GC-MS). The p-DCB was divided into two parts - one part was control sample, and another part was considered as the treated sample which was subjected to biofield energy treatment (The Trivedi Effect®). T1, T2, T3, and T4 were referred the biofield treated p-DCB having analyzed at different time intervals. The GC-MS analysis of both the control and biofield treated p-DCB indicated the presence of the parent molecular ion peak at m/z 146 along with four major fragmentation peaks at m/z 111, 75, 55 and 50. Publisher: Science Publishing Group

Scientists and Researchers Network - I am in Science - Member Profile - Mahendra Kumar Trivedi About Mahendra T­rivedi ear­ned his 5-­year Bache­lor’s degr­ee in Mech­anical Eng­ineering i­n 1985 and­ worked as­ an Engine­er for 10 ­years. In­ 1995, Mr.­ Trivedi d­iscovered ­that he ha­d the uniq­ue ability­ to harnes­s the ener­gy from th­e universe­ and trans­mit it to ­anywhere o­n the glob­e, infusin­g it into ­living org­anisms and­ nonliving­ materials­, thus opt­imizing th­eir potent­ial. For ­the next 5­-7 years, ­Trivedi ap­plied this­ newfound ­discovery ­to helping­ people op­timize the­ir potenti­al, and th­is unique ­phenomenon­ resulting­ from Mr. ­ Mahendra Kumar Trivedi Mahendra Kumar Trivedi earned his 5-year Bachelor’s degree in Mechanical Engineering in 1985 and worked as an Engineer for 10 years. In 1995, Mr. Trivedi discovered that he had the unique ability to harness the energy from the universe and transmit it to anywhere on the globe, infusing it into living organisms and nonliving materials, thus optimizing their potential. For the next 5-7 years, Trivedi applied this newfound discovery to helping people optimize their potential, and this unique phenomenon resulting from Mr. Trivedi’s biofield energy treatments became internationally renown as The Trivedi Effect®. Although Mr.

Spectroscopic Characterization of Disulfiram and Nicotinic Acid after Biofield Treatment *The embed functionality can only be used for non commercial purposes. In order to maintain its sustainability, all mass use of content by commercial or not for profit companies must be done in agreement with figshare. Description Disulfiram is being used clinically as an aid in chronic alcoholism, while nicotinic acid is one of a B-complex vitamin that has cholesterol lowering activity. The aim of present study was to investigate the impact of biofield treatment on spectral properties of disulfiram and nicotinic acid.

Mahendra kumar Trivedi Mahendra Kumar Trivedi earned his 5-year Bachelor’s degree in Mechanical Engineering in 1985 . Mahendra Kumar Trivedi worked as an Engineer for 10 years. In 1995, Mr. Trivedi discovered that he had the unique ability to harness the energy from the universe and transmit it to anywhere on the globe, infusing it into living organisms and nonliving materials, thus optimizing their potential. For the next 5-7 years, Trivedi applied this newfound discovery to helping people optimize their potential, and this unique phenomenon resulting from Mr.

Mahendra Kumar Trivedi - Profile Presentation Mahendra Kumar Trivedi has completed his 5-year Bachelor’s degree in Mechanical Engineering in 1985 and had worked as an Engineer for 10 years. In 1995, Mr. Trivedi discovered had the unique ability to harness the energy from the universe and transmit it to anywhere on the globe, infusing it into living organisms and nonliving materials, thus optimizing their potential. For the next 5-7 years, Trivedi applied this newfound discovery to helping people optimize their potential, and this unique phenomenon resulting from Mr.

Impact of an external energy on Staphylococcus epidermis [ATCC –13518] in relation to antibiotic susceptibility and biochemical reactions – An experimental study Purpose: While spiritual and mental energies are known to man, their impact has never been scientifically measurable in the material world and they remain outside the domain of science. The present experiment on Staphylococcus epidermis [ATCC –13518], validate the effects of such energy transmitted through a person, Mahendra Trivedi, which has produced an impact measurable in scientifically rigorous manner. Independent Researcher Summary Mahendra Trivedi earned his 5-year Bachelor’s degree in Mechanical Engineering in 1985 and worked as an Engineer for 10 years. In 1995, Mr. Trivedi discovered that he had the unique ability to harness the energy from the universe and transmit it to anywhere on the globe, infusing it into living organisms and nonliving materials, thus optimizing their potential.

Publication meta - Spectroscopic Characterization of Disulfiram and Nicotinic Acid after Biofield Treatment - Publications - MyScienceWork Disulfiram is being used clinically as an aid in chronic alcoholism, while nicotinic acid is one of a B-complex vitamin that has cholesterol lowering activity. The aim of present study was to investigate the impact of biofield treatment on spectral properties of disulfiram and nicotinic acid. The study was performed in two groups i.e., control and treatment of each drug. The treatment groups were received Mr. "Antimicrobial Sensitivity Pattern of Pseudomonas fluorescens after Bio" by Mahendra Kumar Trivedi Abstract Global emergence of Pseudomonas fluorescens (P. fluorescens) displays a mechanism of resistance to all existing antimicrobials. Due to its strong ability to acquire resistance, there is a need of some alternative treatment strategy. Objective of this study was to investigate the effect of biofield treatment on antimicrobial sensitivity pattern of P. fluorescens. P. fluorescens cells were procured from MicroBioLogics in sealed packs bearing the American Type Culture Collection (ATCC 49838) number. Two sets of ATCC samples were taken in this experiment and denoted as A and B.

Related:  jamesemersonnjmjohnmartin7adelsenhaalanuradhakashyapmichaelrinnmeghnadsahamariaagnesishrinivasanreddyjenytuckerjustinelvas